ANTI-FYN

Code: SAB2108139-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-FYN antibody produced in rabbit has been used in immunoblotting.

Biochem/physiol Actions

Tyrosine-protein kinase (FYN) is a memb...


 En savoir plus

Votre prix
$465.88 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-FYN antibody produced in rabbit has been used in immunoblotting.

Biochem/physiol Actions

Tyrosine-protein kinase (FYN) is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist.FYN controls mitogenic signals and regulates cell cycle entry and proliferation. Upregulation of FYN in thyroid carcinoma plays an important role in tumorigenesis. Overexpression of FYN in brain is linked to Alzheimer′s disease (AD). It is also involved in T-cell signalling, myelination, learning and memory, neuroinflammation, apoptosis and cell adhesion.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Tyrosine-protein kinase (FYN) is located on human chromosome 6q21. It is a 59 kDa protein with the attachment sites for saturated fatty acid addition in the N terminal, a unique region, a Src-homology 3 (SH3) domain, a Src-homology 2 (SH2) domain, a tyrosine kinase domain (SH1) and a C-terminal negative regulatory domain.

Immunogen

Synthetic peptide directed towards the N terminal region of human FYN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... FYN(2534)
mol wt54kDa
NCBI accession no.NM_153048
Quality Level100
shipped inwet ice
species reactivityhorse, rat, human, guinea pig, dog, bovine, rabbit, mouse
storage temp.−20°C
technique(s)immunoblotting: suitable
UniProt accession no.P06241
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.