Anti-DGAT2

Code: sab2106887-100ul D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Dgat2 is an essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fat...


 Read more

Your Price
$634.06 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Dgat2 is an essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. It is required for synthesis and storage of intracellular triglycerides. It probably plays a central role in cytosolic lipid accumulation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

The immunogen for anti-DGAT2 antibody: synthetic peptide derected towards the C terminal of human DGAT2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LMSGGICPVNRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLK

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... DGAT2(84649)mouse ... Dgat2(67800)
mol wt44 kDa
NCBI accession no.NM_026384
Quality Level100
shipped inwet ice
species reactivitybovine, guinea pig, dog, horse, mouse, human, rabbit, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9DCV3
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.