Anti-AMHR2

Code: SAB2106853-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

On ligand binding, Amhr2 forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors p...


 En savoir plus

Votre prix
$600.18 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

On ligand binding, Amhr2 forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. It is a receptor for anti-Muellerian hormone.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

The immunogen for anti-AMHR2 antibody: synthetic peptide derected towards the N terminal of human AMHR2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PAAAQVSPNRRTCVFFEAPGVRGSTKTLGEMVDAGPGPPKGIRCLYSHCC

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... AMHR2(269)mouse ... Amhr2(110542)
mol wt61 kDa
NCBI accession no.NM_144547
Quality Level100
shipped inwet ice
species reactivityrat, horse, pig, rabbit, mouse, dog, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8K592
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.