Non disponible en dehors du Royaume-Uni et de l'Irlande
Biochem/physiol Actions
Fto is a dioxygenase that repairs alkylated DNA and RNA by oxidative demethylation. Fto has highest activity towards single-stranded RNA containing 3-methyluracil, followed by single-stranded DNA containing 3-methylthymine. Fto has low demethylase activity towards single-stranded DNA containing 1-methyladenine or 3-methylcytosine. Fto has no activity towards 1-methylguanine and no detectable activity towards double-stranded DNA. Fto requires molecular oxygen, alpha-ketoglutarate and iron. Fto contributes to the regulation of the global metabolic rate, energy expenditure and energy homeostasis. Fto contributes to the regulation of body size and body fat accumulation.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal of human FTO
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLV
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :