Anti-PJA2

Code: SAB2106619-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

Pja2 has E2-dependent E3 ubiquitin-protein ligase activity. Pja2 is responsible for ubiquitination of cAMP-dependent protein kinase type I and type II...


 En savoir plus

Votre prix
$510.21 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

Pja2 has E2-dependent E3 ubiquitin-protein ligase activity. Pja2 is responsible for ubiquitination of cAMP-dependent protein kinase type I and type II-alpha/beta regulatory subunits and for targeting them for proteasomal degradation. Pja2 is essential for PKA-mediated long-term memory processes.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

The immunogen for anti-PJA2 antibody: synthetic peptide derected towards the N terminal of human PJA2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PAGGYQTITGRRYGRRHAYVSFKPCMTRHERSLGRAGDDYEVLELDDVPK

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PJA2(9867)mouse ... Pja2(224938)
mol wt71 kDa
NCBI accession no.NM_144859
Quality Level100
shipped inwet ice
species reactivityhuman, mouse, rabbit, rat, bovine, dog, horse, guinea pig
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q80U04-2
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.