Non disponible en dehors du Royaume-Uni et de l'Irlande
Biochem/physiol Actions
Pja2 has E2-dependent E3 ubiquitin-protein ligase activity. Pja2 is responsible for ubiquitination of cAMP-dependent protein kinase type I and type II-alpha/beta regulatory subunits and for targeting them for proteasomal degradation. Pja2 is essential for PKA-mediated long-term memory processes.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
The immunogen for anti-PJA2 antibody: synthetic peptide derected towards the N terminal of human PJA2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PAGGYQTITGRRYGRRHAYVSFKPCMTRHERSLGRAGDDYEVLELDDVPK
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :