Anti-POLI

Code: SAB2105830-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

POLI is an error-prone DNA polymerase specifically involved in DNA repair.POLI plays an important role in translesion synthesis, where the normal high...


 En savoir plus

Votre prix
$459.05 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

POLI is an error-prone DNA polymerase specifically involved in DNA repair.POLI plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls.POLI favors Hoogsteen base-pairing in the active site.POLI inserts the correct base with high-fidelity opposite an adenosine template.POLI exhibits low fidelity and efficiency opposite a thymidine template, where it will preferentially insert guanosine.POLI may play a role in hypermutation of immunogobulin genes.POLI forms a Schiff base with 5′-deoxyribose phosphate at abasic sites, but may not have lyase activity.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human POLI

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLD

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... POLI(11201)
mol wt83 kDa
NCBI accession no.NM_007195
Quality Level100
shipped inwet ice
species reactivitybovine, mouse, guinea pig, rabbit, horse, rat, dog, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9UNA4
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.