Non disponible en dehors du Royaume-Uni et de l'Irlande
Biochem/physiol Actions
POLI is an error-prone DNA polymerase specifically involved in DNA repair.POLI plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls.POLI favors Hoogsteen base-pairing in the active site.POLI inserts the correct base with high-fidelity opposite an adenosine template.POLI exhibits low fidelity and efficiency opposite a thymidine template, where it will preferentially insert guanosine.POLI may play a role in hypermutation of immunogobulin genes.POLI forms a Schiff base with 5′-deoxyribose phosphate at abasic sites, but may not have lyase activity.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human POLI
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLD
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :