Anti-SLC38A5

Code: sab2105557-100ul D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

The protein encoded by this gene is a system N sodium-coupled amino acid transporter involved in the transfer of glutamine, asparagine, histidine, ser...


 Read more

Your Price
$611.17 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

The protein encoded by this gene is a system N sodium-coupled amino acid transporter involved in the transfer of glutamine, asparagine, histidine, serine, alanine, and glycine. The encoded protein does not transport charged amino acids, imino acids, or N-

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC38A5

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GIRAYEQLGQRAFGPAGKVVVATVICLHNVGAMSSYLFIIKSELPLVIGT

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SLC38A5(92745)
mol wt51 kDa
NCBI accession no.NM_033518
Quality Level100
shipped inwet ice
species reactivityhuman, rat, mouse, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8WUX1
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.