Anti-Jarid2

Code: SAB2105340-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

Jarid2 is a regulator of histone methyltransferase complexes that plays an essential role in embryonic development, including heart and liver developm...


 En savoir plus

Votre prix
$611.17 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

Jarid2 is a regulator of histone methyltransferase complexes that plays an essential role in embryonic development, including heart and liver development, neural tube fusion process and hematopoiesis.Jarid2 acts by modulating histone methyltransferase activity and promoting the recruitment of histone methyltransferase complexes to their target genes.Jarid2 binds DNA and mediates the recruitment of the PRC2 complex to target genes in embryonic stem cells.Jarid2 does not have histone demethylase activity but regulates activity of various histone methyltransferase complexes. In embryonic stem cells, it associates with the PRC2 complex and inhibits trimethylation of ′Lys-27′ of histone H3 (H3K27me3) by the PRC2 complex, thereby playing a key role in differentiation of embryonic stem cells and normal development. In cardiac cells, it is required to repress expression of cyclin-D1 (CCND1) by activating methylation of ′Lys-9′ of histone H3 (H3K9me) by the GLP1/EHMT1 and G9a/EHMT2 histone methyltransferases.Jarid2 also acts as a transcriptional repressor of ANF via its interaction with GATA4 and NKX2-5.Jarid2 participates in the negative regulation of cell proliferation signaling.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of mouse Jarid2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: NASSSCQSTPRKGKTHKHVHNGHVFNGSSRSAREKEPAHKHRSKEATPGK

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... JARID2(3720)mouse ... Jarid2(16468)
mol wt137 kDa
NCBI accession no.NM_021878
Quality Level100
shipped inwet ice
species reactivitymouse, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q62315
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.