Anti-METTL3

Code: SAB2104747-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-METTL3 antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

Methyltransferase like 3 (METTL3) ...


 En savoir plus

Votre prix
$518.29 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-METTL3 antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

Methyltransferase like 3 (METTL3) is part of methyltransferase systems that mediates the m6methyladenosine modifications. It exists as a heterodimeric complex with METTL14. An elevated expression of METTL3 is observed in clear cell renal cell carcinoma and rheumatoid arthritis (RA). Mutations in the METTL3 gene are implicated in autoimmune thyroid disease (AITD) and neuroblastoma. It may function as a tumor-suppresser in colorectal cancer.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Methyltransferase like 3 (METTL3), an RNA methyltransferase, is a member of the class I methyltransferase (MTase) family and contains the MTase domain. The METTL3 gene is mapped to human chromosome 14q11.2.

Immunogen

Synthetic peptide directed towards the middle region of human METTL3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: IVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLD

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... METTL3(56339)
mol wt64 kDa
NCBI accession no.NM_019852
Quality Level100
shipped inwet ice
species reactivitybovine, dog, rat, horse, guinea pig, human, rabbit, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q86U44
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.