Anti-FBXL14

Code: sab2103691-100ul D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

FBXL14 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family,...


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

FBXL14 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL14, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human FBXL14

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... FBXL14(144699)
mol wt46 kDa
NCBI accession no.NM_152441
Quality Level100
shipped inwet ice
species reactivityhorse, rat, guinea pig, mouse, bovine, rabbit, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8N1E6
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.