Anti-TMEM35

Code: SAB2102467-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

Transmembrane protein 35 (TMEM35) is a multi-pass membrane protein. Any alteration in Transmembrane protein 35 (TMEM35) causes long term memory loss a...


 En savoir plus

Votre prix
$611.17 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

Transmembrane protein 35 (TMEM35) is a multi-pass membrane protein. Any alteration in Transmembrane protein 35 (TMEM35) causes long term memory loss as well as impairs behavioral functions. TMEM35 regulates cell cycle progression and thereby modulates osteosarcoma cell growth, migration and invasion, making it a potent drug development target for therapeutics. In zona glomerulosa, the neurite outgrowth after sodium depletion is regulated by TMEM35.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Transmembrane protein 35 (TMEM35) is mostly expressed in hypothalamic-pituitary-adrenal (HPA) circuitry and limbic areas, including the hippocampus and amygdala of mice. TMEM35 sis also known as the unknown factor-1(TUF-1). Human TMEM35 consists of 167 amino acids and is located at human chromosome Xq22.

Immunogen

Synthetic peptide directed towards the C terminal region of human TMEM35

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TMEM35(59353)
mol wt18 kDa
Quality Level100
shipped inwet ice
species reactivityrabbit, mouse, rat, human, guinea pig, horse, bovine
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q53FP2
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.