Anti-SLC22A6

Code: SAB2102177-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

Solute carrier family 22 member 6 (SLC22A6) is involved in the sodium-dependent transport and excretion of organic anions, some of which are potential...


 En savoir plus

Votre prix
$611.17 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

Solute carrier family 22 member 6 (SLC22A6) is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane. Four transcript variants encoding four different isoforms have been found for this gene.SLC22A6 regulates the body disposition of a variety of clinically important drugs, such as, anti-HIV therapeutics, antitumor drugs, antibiotics, antihypertensives and anti-inflammatories. Ubiquitination sites of SLC22A6 is involved in the protein kinase C (PKC)-mediated endocytosis of the transporter. It plays an important role in substrate recognition.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Solute carrier family 22 member 6 (SLC22A6) belongs to organic anion transporter-1 family. The protein is expressed in kidney and brain. The gene is located on human chromosome 11q12.3.

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC22A6

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: AFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRP

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SLC22A6(9356)
mol wt62 kDa
Quality Level100
shipped inwet ice
species reactivitybovine, mouse, dog, rabbit, human, horse, rat, guinea pig
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q4U2R8
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.