Not available outside of the UK & Ireland.
Biochem/physiol Actions
Insulin-like growth factor 1 receptor (IGF1R) is prime for IGF-1 for its mitogenic and metabolic functionality. It binds to IGF1 and IGF2 and activates phosphatidylinositol 3?kinase (PI3K)/protein kinase B (AKT) and mitogen-activated protein kinase pathways. IGF1R plays a key role in growth, differentiation, cell metabolic events, and apoptosis. It also favors proliferation in the myelodysplastic syndrome (MDS) and may serve as a potential target to treat MDS. Mutations in the IGF1R gene are implicated in the pre- and postnatal growth retardation and microcephaly. High levels of IGF1R overexpression are observed in multiple myeloma, lung, breast, bladder and pancreatic tumors.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Insulin-like growth factor 1 receptor (IGF1R), a transmembrane tyrosine kinase receptor, belongs to the insulin receptor family. It comprises juxtamembrane (JM) and transmembrane domains that harbor substrate binding sites. Structurally, IGF1R exists as a tetramer α2/β2 with the extracellular dimeric α subunits. The IGF1R gene is mapped to human chromosome 15q26.3.
Immunogen
Synthetic peptide directed towards the middle region of human IGF1R
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
This product has met the following criteria to qualify for the following awards: