Anti-ÉPÉE

Code: SAB2100693-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-EPOR antibody produced in rabbit has been used in immunoblot analysis and magnetic cell sorting.

Biochem/physiol Actions

The ery...


 En savoir plus

Votre prix
$556.54 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-EPOR antibody produced in rabbit has been used in immunoblot analysis and magnetic cell sorting.

Biochem/physiol Actions

The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis.The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human EPOR

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... EPOR(2057)
InChI keyQLXNJYBNAORLFC-CLFAGFIQSA-N
InChI1S/C40H74O3/c1-3-5-7-9-11-13-15-17-19-21-23-25-27-29-31-33-35-37-39(41)43-40(42)38-36-34-32-30-28-26-24-22-20-18-16-14-12-10-8-6-4-2/h17-20H,3-16,21-38H2,1-2H3/b19-17-,20-18-
mol wt53 kDa
Quality Level100
shipped inwet ice
species reactivitydog, human, mouse, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P19235
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.