Anti-EPAS1

Code: SAB2100686-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

EPAS1 is a transcription factor involved in the induction of oxygen regulated genes. EPAS1 binds to core DNA sequence 5′-[AG]CGTG-3′ withi...


 En savoir plus

Votre prix
$511.01 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

EPAS1 is a transcription factor involved in the induction of oxygen regulated genes. EPAS1 binds to core DNA sequence 5′-[AG]CGTG-3′ within the hypoxia response element (HRE) of target gene promoters. EPAS1 regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. EPAS1 may also play a role in the formation of the endothelium that gives rise to the blood brain barrier. EPAS1 is a potent activator of the Tie-2 tyrosine kinase expression. The activation seems to require recruitment of transcriptional coactivators such as CREBPB and probably EP300. Interaction of EPAS1 with redox regulatory protein APEX seems to activate CTAD.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human EPAS1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGD

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... EPAS1(2034)
mol wt90 kDa
Quality Level100
shipped inwet ice
species reactivityhuman, horse, guinea pig, dog, rat, mouse, rabbit, bovine
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q99814
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.