Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Anti-CCK antibody produced in rabbit has been used in staining.
Biochem/physiol Actions
Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
CCK codes for cholecystokinin. It is a brain/gut peptide. This gene is located on human chromosome 3p22.
Immunogen
Synthetic peptide directed towards the middle region of human CCK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :