Non disponible en dehors du Royaume-Uni et de l'Irlande
Biochem/physiol Actions
BHLHB3 may be a transcriptional repressor that represses both basal and activated transcription. It play a role as a tumor suppressor for lung cancer. DEC1 and DEC2(BHLHB3) may play a crucial role in the adaptation to hypoxia and are regulators of the mammalian molecular clock, and form a fifth clock-gene family.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human BHLHB3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTI
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :