Anti-BACE1

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

β-site APP cleaving enzyme (BACE-1) acts as a rate-limiting enzyme of amyloid-β-peptide (Aβ). Overexpression of BACE-1 leads to increased β-secretase activity.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.

β-site APP cleaving enzyme (BACE-1) is known as β-secretase. It consists of an N-terminal signal peptide (SP), a pro-peptide (Pro) domain, a catalytic domain, a transmembrane domain and a C-terminal tail.

Immunogen

Synthetic peptide directed towards the N terminal region of human BACE1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY