ANTI-APPL1

Code: HPA073477-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the mos...


 En savoir plus

Votre prix
$620.60 EACH

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.Every Prestige Antibody is tested in the following ways: IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues. Protein array of 364 human recombinant protein fragments.

Immunogen

Recombinant protein corresponding to adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1. Sequence KIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNR

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Physical form

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
conjugateunconjugated
formbuffered aqueous glycerol solution
Gene Informationhuman ... APPL1(26060)
packagingantibody small pack of 25 µL
product linePrestige Antibodies® Powered by Atlas Antibodies
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: 0.04-0.4 µg/mL
UniProt accession no.Q9UKG1
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.