Not available outside of the UK & Ireland.
Application
Anti-LGALS3BP antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.
Biochem/physiol Actions
LGALS3BP (Lectin, galactoside-binding, soluble, 3 binding protein) or MAC-2-BP gene encodes a Galectin-3-binding protein localized to chromosome 17q25. It is widely expressed by keratinocytes and fibroblasts but is also present in fluids like- semen, milk, serum, tears, saliva and urine. LGALS3BP stimulates the intergrin-mediated cell adhesion. It also imposes stimulatory impact on host defense system like natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Furthermore, the encoded protein interacts specifically with galectin-1 and galectin-3 and facilitates the formation of multicell aggregates.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human LGALS3BP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS
This product has met the following criteria to qualify for the following awards: