Anti-ATG10

Code: av54274-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-ATG10 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

At...


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Application

Anti-ATG10 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

Atg10 is an E2-like enzyme that facilitates the addition of ubiquitination modifications essential for autophagosome formation. It catalyzes the conjugation of ATG12 to ATG5, which is essential for proper localization of ATG8 to the preautophagosomal structure (PAS). Further, Atg10 also plays a role in modifying the soluble form of LC3 to the membrane-bound form during Atg12 conjugation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ATG10 [autophagy related 10 homolog (S. cerevisiae)] or APG10 gene encodes a protein necessary for autophagy in yeast. Autophagy is a catabolic cellular event that includes cell death of superfluous or dysfunctional cellular components, cell differentiation and aging. It is also crucial for the maintenance of amino acid levels and protein synthesis under nitrogen starvation and is enhanced under certain conditions such as hormonal stimulation and drug treatments.

Immunogen

Synthetic peptide directed towards the C terminal region of human ATG10

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ATG10(83734)
mol wt25 kDa
NCBI accession no.NP_113670
Quality Level100
shipped inwet ice
species reactivitymouse, human, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9H0Y0
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.