Anti-PAOX

Code: AV53829-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-PAOX (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

...


 En savoir plus

Votre prix
$518.29 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-PAOX (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

PAOX [polyamine oxidase (exo-N4-amino)] encodes a FAD containing enzyme that catalyzes the oxidation of N(1)-acetylspermine and N1-acetylspermidine to spermidine and putrescine, respectively. It is, therefore, involved in the polyamine back-conversion. It also facilitates the regulation of polyamine intracellular concentration.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human PAOX

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LCLTQVLRRVTGNPRLPAPKSVLRSRWHSAPYTRGSYSYVAVGSTGGDLD

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PAOX(196743)
mol wt25 kDa
NCBI accession no.NP_690875
Quality Level100
shipped inwet ice
species reactivitydog, bovine, rat, human, rabbit, horse, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q6QHF9
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.