Anti-LPIN1

Code: AV53826-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-LPIN1 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

LP...


 En savoir plus

Votre prix
$459.05 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-LPIN1 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

LPIN1 (lipin 1) encodes a magnesium-ion-dependent phosphatidic acid phosphohydrolase enzyme that catalyzes the dephosphorylation of phosphatidic acid to form diacylglycerol. It is a transcriptional co-regulator that regulates lipid metabolism and adipogenesis (adipocyte maturation and maintenance) by modulating the C/EBPα (CCAAT/enhancer-binding protein α) and PPAR γ (peroxisome-proliferator-activated receptor γ) network. Lipin 1 also plays a pivotal role in controlling autophagy clearance by facilitating the maturation of autolysosomes via stimulation of protein kinase D (PKD)-Vps34 phosphatidylinositol 3-kinase signaling cascade.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human LPIN1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... LPIN1(23175)
mol wt98 kDa
NCBI accession no.NP_663731
Quality Level100
shipped inwet ice
species reactivityrabbit, dog, mouse, rat, horse, human
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q14693
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.