Anti-TNNT3

Code: AV51287-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-TNNT3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25µg/ml.

Biochem/physiol Actions


 En savoir plus

Votre prix
$456.36 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-TNNT3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25µg/ml.

Biochem/physiol Actions

Troponin T type 3 (TNNT3) is a fast-twitch muscle protein belonging to the troponin T gene family. It forms a complex that regulates striated muscle contraction along with troponins C and I. Two isoforms of TNNT3 are present, the fetal/neonatal and the adult isoforms and a developmental switch of the isoforms occurs. Mutations in TNNT3 have been identified in distal arthrogryposis multiplex congenita type 2B and Sheldon-Hall syndrome.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human TNNT3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TNNT3(7140)
mol wt30 kDa
NCBI accession no.NP_001036245
Quality Level100
shipped inwet ice
species reactivityguinea pig, dog, bovine, mouse, horse, rat, goat, human, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P45378-4
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.