Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Anti-TNNT3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25µg/ml.
Biochem/physiol Actions
Troponin T type 3 (TNNT3) is a fast-twitch muscle protein belonging to the troponin T gene family. It forms a complex that regulates striated muscle contraction along with troponins C and I. Two isoforms of TNNT3 are present, the fetal/neonatal and the adult isoforms and a developmental switch of the isoforms occurs. Mutations in TNNT3 have been identified in distal arthrogryposis multiplex congenita type 2B and Sheldon-Hall syndrome.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human TNNT3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :