Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Anti-TNNI2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25µg/ml.
Biochem/physiol Actions
Troponin I type 2 (TNNI2) is a fast-twitch muscle protein belonging to the troponin I gene family. It forms a complex that regulates striated muscle contraction along with troponins T and C. TNNI2 also has a role in smooth muscle contraction, angiogenesis, metastasis and tumor growth. Mutations in TNNI2 gene have been implicated in myopathy1 and distal arthrogryposis type 2B.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human TNNI2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :