Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Rabbit Anti-SIN3B antibody is suitable for western blot applications at a concentration of 1µg/ml.
Biochem/physiol Actions
SIN3B acts as a transcriptional repressor. It interacts with MXI1 to repress MYC responsive genes and antagonize MYC oncogenic activities.It also interacts with MAD-MAX heterodimers by binding to MAD. The heterodimer then represses transcription by tethering SIN3B to DNA. SIN3B also forms a complex with FOXK1 which represses transcription.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
SIN3B codes for SIN3 transcription regulator family member B that interacts with Mad1. It is also known to form a nucleolar complex with leukemia associated ETO homologs.Rabbit Anti-SIN3B antibody recognizes human, bovine, and mouse SIN3B.
Immunogen
Synthetic peptide directed towards the middle region of human SIN3B
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NDTKALRSKSLLNEIESVYDEHQEQHSEGRSAPSSEPHLIFVYEDRQILE
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :