Anti-CACHD1

Code: av49592-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-CACHD1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions


 Read more

Your Price
$610.95 100UL

Not available outside of the UK & Ireland.

Application

Anti-CACHD1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

CACHD1 (Cache domain-containing protein 1) is a calcium channel protein that is important for excitation-contraction coupling. It is differentially regulated in humans suffering from parkinson disease. CACHD1 is up-regulated in human embryonic stem cells and is down-modulated upon differentiation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The gene CAHD1 (Cache domain-containing protein 1) is mapped to human chromosome 1p31.3.

Immunogen

Synthetic peptide directed towards the N terminal region of human CACHD1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CACHD1(57685)
mol wt137 kDa
NCBI accession no.NP_065976
Quality Level100
shipped inwet ice
species reactivityrat, rabbit, human, horse, dog, bovine, guinea pig, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q5VU97
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.