Anti-CDYL2

Code: AV49048-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-CDYL2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5µg/ml.

Biochem/physiol Actions

...


 En savoir plus

Votre prix
$611.17 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-CDYL2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5µg/ml.

Biochem/physiol Actions

Chromodomain protein, Y-like 2 (CDYL2) belongs to the family of chromodomain Y chromosome (CDY) proteins that mediate histone acetylation during spermiogenesis and regulation of transcription corepressors. CDYL2 binds to multiple ARK(S/T) motifs and is present in all mammals.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human CDYL2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: NPPLAKPKKGYSGKPSSGGDRATKTVSYRTTPSGLQIMPLKKSQNGMENG

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CDYL2(124359)
mol wt56 kDa
NCBI accession no.NP_689555
Quality Level100
shipped inwet ice
species reactivityhuman, mouse, bovine, rabbit, rat, guinea pig, horse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8N8U2
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.