Anti-LIPT1

Code: AV48784-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-LIPT1 antibody is suitable for western blot application at a concentration of 1µg/ml.

Biochem/physiol Actions

The pr...


 En savoir plus

Votre prix
$611.17 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-LIPT1 antibody is suitable for western blot application at a concentration of 1µg/ml.

Biochem/physiol Actions

The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, LIPT1 transfers the lipoyl moiety to apoproteins.The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, the protein encoded by this gene transfers the lipoyl moiety to apoproteins. Alternative splicing in the 5′ UTR of this gene results in five transcript variants that encode the same protein.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

LIPT1 codes for lipoyltransferase 1 catalyzes the transfer of lipoyl groups to apoproteins. It is involved in the modification of cellular proteins and lipid metabolism.Rabbit Anti-LIPT1 antibody recognizes chicken, rat, canine, bovine, human, and mouse LIPT1.

Immunogen

Synthetic peptide directed towards the N terminal region of human LIPT1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... LIPT1(51601)
mol wt42 kDa
NCBI accession no.NP_660197
Quality Level100
shipped inwet ice
species reactivityhorse, dog, human, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9Y234
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.