Anti-NAT6

Code: AV48733-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-NAT6 antibody is suitable for western blot applications at a concentration of 1µg/ml.

Biochem/physiol Actions

NAT6 b...


 En savoir plus

Votre prix
$518.29 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-NAT6 antibody is suitable for western blot applications at a concentration of 1µg/ml.

Biochem/physiol Actions

NAT6 belongs to the acetyltransferase family. It contains 1 N-acetyltransferase domain. NAT6 seems to be involved in N-acetylation. Acts on peptides with a N-terminal Met followed by Asp/Glu/Asn. It may act as a tumor suppressor. Defects in NAT6 are found in non-small cell lung cancer (NSCLC) cell lines.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

NAT6 codes for N-acetyltransferase 6 (GCN5-related), a cytoplasmic enzyme that is specific for N-terminal methionine-containing proteins. Rabbit Anti-NAT6 antibody recognizes human NAT6.

Immunogen

Synthetic peptide directed towards the C terminal region of human NAT6

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGP

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... NAT6(24142)
mol wt34 kDa
NCBI accession no.NP_036323
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q93015
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.