Anti-GOT1

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-GOT1 antibody is suitable for western blot applications at a concentration of 5µg/ml.

Biochem/physiol Actions

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Glutamic-oxaloacetic transaminase 1, soluble (GOT1) is an enzyme that is involved in the metabolism of amino acids. It is also involved in tricarboxylic acid and area cycles. Studies have reported that GOT1 plays a role in vesicle formation from the ER. GOT1 has been xenografted to nude mice for radiotherapy studies.Rabbit Anti-GOT1 antibody recognizes human, mouse, rat, bovine, pig, and chicken GOT1.

Immunogen

Synthetic peptide directed towards the N terminal region of human GOT1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV