Anti-PDHA1

Code: AV48136-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-PDHA1 antibody is suitable for western blot applications at a concentration of 5µg/ml.

Biochem/physiol Actions

The p...


 En savoir plus

Votre prix
$455.72 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-PDHA1 antibody is suitable for western blot applications at a concentration of 5µg/ml.

Biochem/physiol Actions

The pyruvate dehydrogenase complex is a nuclear-encoded mitochondrial matrix multienzyme complex that provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle by catalyzing the irreversible conversion of pyruvate into acetyl-CoA. The PDH complex is composed of multiple copies of 3 enzymes: E1 (PDHA1); dihydrolipoyl transacetylase (DLAT); and dihydrolipoyl dehydrogenase (DLD). The E1 enzyme is a heterotetramer of 2 alpha and 2 beta subunits. The E1-alpha subunit contains the E1 active site and plays a key role in the function of the PDH complex.The pyruvate dehydrogenase complex is a nuclear-encoded mitochondrial matrix multienzyme complex that provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle by catalyzing the irreversible conversion of pyruvate into acetyl-CoA. The PDH complex is composed of multiple copies of 3 enzymes: E1 (PDHA1); dihydrolipoyl transacetylase (DLAT; MIM 608770) (E2; EC 2.3.1.12); and dihydrolipoyl dehydrogenase (DLD; MIM 238331) (E3; EC 1.8.1.4). The E1 enzyme is a heterotetramer of 2 alpha and 2 beta subunits. The E1-alpha subunit contains the E1 active site and plays a key role in the function of the PDH complex (Brown et al., 1994 [PubMed 7853374]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

PDHA1 codes for the α1 subunit of the pyruvate dehydrogenase complex and modulates the activity of the complex. PDHA1 mutations have been implicated in pyruvate dehydrogenase deficiency.Rabbit Anti-PDHA1 antibody recognizes bovine, chicken, pig, human, mouse, rat, and canine PDHA1.

Immunogen

Synthetic peptide directed towards the N terminal region of human PDHA1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PDHA1(5160)
mol wt40 kDa
NCBI accession no.NP_000275
Quality Level100
shipped inwet ice
species reactivityrat, human, guinea pig, dog, rabbit, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P08559
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.