Anti-LAPTM4A

Code: av47057-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-LAPTM4A antibody produced in rabbit is suitable for western blotting at a concentration of 5µg/mL.

Biochem/physiol Actions

...


 Read more

Your Price
$378.28 100UL

Not available outside of the UK & Ireland.

Application

Anti-LAPTM4A antibody produced in rabbit is suitable for western blotting at a concentration of 5µg/mL.

Biochem/physiol Actions

LAPTM4A is a protein that has four predicted transmembrane domains. The function of its gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.This gene encodes a protein that has four predicted transmembrane domains. The function of this gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

LAPTM4A is a protein that has four predicted transmembrane domains. The function of its gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.This gene encodes a protein that has four predicted transmembrane domains. The function of this gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.

Immunogen

Synthetic peptide directed towards the middle region of human LAPTM4A

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... LAPTM4A(9741)
mol wt27 kDa
NCBI accession no.NP_055528
Quality Level100
shipped inwet ice
species reactivityrat, rabbit, mouse, bovine, guinea pig, human, horse, dog
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q15012
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.