Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Anti-EIF2S3 antibody produced in rabbit is suitable for western blotting at a concentration of 5µg/ml.
Biochem/physiol Actions
EIF2S3 gene encodes a eukaryotic translation initiation factor 2, subunit 3 gamma protein of 52kDa. It is the core subunit of the heterotrimeric GTP-binding protein that facilitates the recruitment of methionyl-tRNA to the 40S ribosomal subunit.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human EIF2S3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :