Anti-SAMSN1

Code: av45875-100ul D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

SAMSN1 (SAM domain, SH3 domain, and nuclear localization signals 1), also known as HACS1/SLY2/NASH1, is a member of a family of three adapter proteins...


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

SAMSN1 (SAM domain, SH3 domain, and nuclear localization signals 1), also known as HACS1/SLY2/NASH1, is a member of a family of three adapter proteins that are highly homologous and characterized by the presence of protein-protein interaction domains. The SAMSN1 gene localizes to the 21q11.2 region on human chromosome 21. The transcript of SAMSN1 has been found in acute myeloid leukemia, lymphoma, and multiple myeloma cell-lines.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human SAMSN1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: YVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGY

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SAMSN1(64092)
mol wt42 kDa
NCBI accession no.NP_071419
Quality Level100
shipped inwet ice
species reactivityrat, bovine, rabbit, dog, mouse, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9NSI8
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.