Anti-SPPL2B

Code: av44989-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-SPPL2B polyclonal antibody is used to tag signal peptide peptidase-like 2B for detection and quantitation by Western blotting and in plasma by immunohistoche...


 Read more

Your Price
$557.33 100UL

Not available outside of the UK & Ireland.

Application

Anti-SPPL2B polyclonal antibody is used to tag signal peptide peptidase-like 2B for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of signal peptide peptidase-like 2B as a cell signal regulator by mediating the intra-membrane proteolysis of membrane-anchored signaling factors.

Biochem/physiol Actions

SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Signal peptide peptidase-like 2B (SPPL2B, IMP4, PSL1), a homologue of signal peptidase, is a GxGD aspartyl protease that catalyzes regulated intra-membrane proteolysis of type II membrane-anchored signaling factors. SPPL2b catabolizes signaling substrates such as TNFα and Bri2.

Immunogen

Synthetic peptide directed towards the N terminal region of human SPPL2B

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL

Specificity

Anti-SPPL2B polyclonal antibody reacts with human, mouse, rat, chicken, and bovine signal peptide peptidase-like 2B proteins.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SPPL2B(56928)
mol wt56 kDa
NCBI accession no.NP_001070706
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q8TCT7-4
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.