Anti-LOC203547

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-LOC203547 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0µg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8µg/ml.

Biochem/physiol Actions

The protein encoded by LOC203547 is VMA21 vacuolar H+-ATPase homolog (VMA21), a chaperone for the assembly of lysosomal vacuolar ATPase, the major proton pump of cellular membrane in mammals. Mutations in VMA21 gene causes X-linked myopathy with excessive cell vacuolation, autophagy and tissue atrophy.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human LOC203547

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS