Anti-LRRC26

Code: AV44660-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-LRRC26 polyclonal antibody is used to tag leucine-rich repeat (LRR)-containing protein 26 for detection and quantitation by Western blotting and in plasma by...


 En savoir plus

Votre prix
$611.17 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-LRRC26 polyclonal antibody is used to tag leucine-rich repeat (LRR)-containing protein 26 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of leucine-rich repeat (LRR)-containing protein 26 as a modulator of BK channel hyperpolarization activation and Slo3 channel alkalization activation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Leucine-rich repeat (LRR)-containing protein 26 (LRRC26) functions as an auxiliary protein that complexes with and modulates the activation requirements of large-conductance, voltage- and calcium-activated potassium (BK, or K(Ca)1.1) and alkaline activated Slo channels. LRRC26 modulates the gating of a BK channel by enhancing the allosteric coupling between voltage-sensor activation and the channel′s closed-open transition.

Immunogen

Synthetic peptide directed towards the middle region of human LRRC26

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA

Specificity

Anti-LRRC26 polyclonal antibody reacts with canine and human leucine-rich repeat (LRR)-containing protein 26 proteins.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... LRRC26(389816)
mol wt37 kDa
NCBI accession no.NP_001013675
Quality Level100
shipped inwet ice
species reactivitydog, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q2I0M4
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.