Anti-PSEN2

Code: av44289-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-PSEN2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml and for immunohistochemistry of paraffin-embedded tiss...


 Read more

Your Price
$472.52 100UL

Not available outside of the UK & Ireland.

Application

Anti-PSEN2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8µg/ml.

Biochem/physiol Actions

Presenilin 2 (PSEN2; PS2; AD4) regulates the activity of γ-secretase, the enzyme that cleaves amyloid precursor protein (APP). Studies indicate that PSEN2 also might regulate the cleavage of Notch receptor that in turn regulates gamma-secretase activity. Presenilins regulate the release of neurotransmitters at the synapses and intracellular Ca+2 homeostasis. Mutations in gene encoding presenilins are linked to familial Alzheimer′s disease.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human PSEN2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PSEN2(5664)
mol wt49 kDa
NCBI accession no.NP_000438
Quality Level100
shipped inwet ice
species reactivityrabbit, human, dog, bovine, rat, mouse, horse, guinea pig
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P49810
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.