Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Anti-SLC25A39 polyclonal antibody is used to tag solute carrier family 25, member 39 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 25, member 39 in mitochondrial transport in support of iron-dependent processes such as heme biosynthesis.
Biochem/physiol Actions
SLC25A39 is a member of the solute carrier family 25 and is known to transport molecules over the mitochondrial membrane.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Solute carrier family 25, member 39 (SLC25A39, CGI69) is a member of the SLC25 carrier family that mediates transport across the inner mitochondrial membrane. SLC25A39 may be involve in the incorporation of iron into protoporphyrin IX, an essential step in heme biosynthesis.
Immunogen
Synthetic peptide directed towards the C terminal region of human SLC25A39
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF
Specificity
Anti-SLC25A39 polyclonal antibody reacts with human, mouse, rat, canine, bovine, and zebrafish solute carrier family 25, member 39 proteins.
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :