Anti-SLC25A14

Code: AV43861-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-SLC25A14 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5µg/ml.

Biochem/physiol Actions

...


 En savoir plus

Votre prix
$455.72 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-SLC25A14 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5µg/ml.

Biochem/physiol Actions

SLC25A14 is a mitochondrial uncoupling protein (UCP) belonging to the family of mitochondrial anion carrier proteins (MACP). The UCPs mediate the transfer of anions from inner to outer mitochondrial membrane and transfer of protons in the reverse direction. Altered expression of SLC25A14 gene has been observed in autism spectrum disorders and in cardiovascular disorders.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC25A14

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SLC25A14(9016)
mol wt21 kDa
NCBI accession no.NP_073721
Quality Level100
shipped inwet ice
species reactivityrat, human, bovine, dog, mouse, guinea pig, horse, rabbit, sheep
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q5JY88
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.