Anti-ANKRD2

Code: AV42559-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-ANKRD2 polyclonal antibody is used to tag Ankyrin repeat domain 2 proteins for detection and quantitation by Western blotting and in cells and tissues by imm...


 En savoir plus

Votre prix
$459.05 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-ANKRD2 polyclonal antibody is used to tag Ankyrin repeat domain 2 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role Ankrd2 in muscle cell development.

Biochem/physiol Actions

ANKRD2 may play an important role in skeletal muscle hypertrophy.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Ankyrin repeat domain 2 (stretch responsive muscle) (Ankrd2), a MARP mechanosensing protein, is believed to be involved in skeletal muscle hypertrophy through the regulation of cell signaling and gene expression within muscle cells.

Immunogen

Synthetic peptide directed towards the N terminal region of human ANKRD2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL

Specificity

Anti-ANKRD2 antibody reacts with canine, human, mouse, and rat ankyrin repeat domain 2 (stretch responsive muscle) proteins.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ANKRD2(26287)
mol wt49 kDa
NCBI accession no.NP_001123453
Quality Level100
shipped inwet ice
species reactivityguinea pig, rat, bovine, dog, horse, human, rabbit, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q3B778
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.