Anti-PBEF1

Code: AV42254-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-PBEF1 (AB1) polyclonal antibody is used to tag pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase/visfatin detection and quantitatio...


 En savoir plus

Votre prix
$449.63 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-PBEF1 (AB1) polyclonal antibody is used to tag pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase/visfatin detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase/visfatin in adipose tissue inflammation, as a cancer serum marker and as an NAD biosynthesis salvage pathway enzyme.

Biochem/physiol Actions

PBEF1 catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein is an adipokine that is localized to the bloodstream and has various functions, including the promotion of vascular smooth muscle cell maturation and inhibition of neutrophil apoptosis. It also activates insulin receptor and has insulin-mimetic effects, lowering blood glucose and improving insulin sensitivity. The protein is highly expressed in visceral fat and serum levels of the protein correlate with obesity.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase (PBEF1, NAMPT, visfatin) is a rate limiting enzyme that promotes the salvage pathway biosynthesis of nicotinamide mononucleotide and nicotinamide dinucleotide (NAD) by catalyzing the condenstation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate. PBEF1 promotes B-cell maturation and vascular smooth muscle cell differentiaton. Visfatin/PBEF/Nampt is also a proinflammatory cytokine and marker of adipose tissue associated with systemic insulin resistance and hyperlipidemia. PBEF1 is a potential malignant astrocytoma serum marker and prognostic indicator among glioblastoma (GBM).

Immunogen

Synthetic peptide directed towards the C terminal region of human PBEF1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL

Specificity

Anti-PBEF1 (AB1) polyclonal antibody reacts with chicken, zebrafish, human, mouse, rat, canine, and pig pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase/visfatin proteins.

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PBEF1(10135)
mol wt54 kDa
NCBI accession no.NP_005737
Quality Level100
shipped inwet ice
species reactivityrabbit, mouse, guinea pig, rat, horse, human, dog, bovine
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P43490
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.