Anti-DCX

Code: AV41333-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. DCX is a cytoplasmic pro...


 En savoir plus

Votre prix
$611.17 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. DCX is a cytoplasmic protein which appears to direct neuronal migration by regulating the organization and stability of microtubules. The protein contains two doublecortin domains, which bind microtubules. In addition, DCX interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex.In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. The protein encoded by this gene is a cytoplasmic protein which appears to direct neuronal migration by regulating the organization and stability of microtubules. The encoded protein contains two doublecortin domains, which bind microtubules. In addition, the encoded protein interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex. Mutations in this gene are a cause of X-linked lissencephaly. Multiple transcript variants encoding at least three different isoforms have been found for this gene.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human DCX

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... DCX(1641)
mol wt40 kDa
NCBI accession no.NP_835364
Quality Level100
shipped inwet ice
species reactivityhuman, mouse, rat
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.O43602
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.