Anti-EHF

Code: av40136-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-EHF polyclonal antibody is used to tag ETS homologous factor proteins for detection and quantitation by Western blotting and in cells and tissues by immunohi...


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Application

Anti-EHF polyclonal antibody is used to tag ETS homologous factor proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of ETS homologous factor as a potential prognostic marker for carcinomas such as ovarian carcinoma cancer and to study gene regulation during carcinogenesis.

Biochem/physiol Actions

Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation. It may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. It binds to DNA sequences containing the consensus nucleotide core sequence GGAA and involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ETS transcription factors share a conserved DNA-binding "ETS" domain and include several oncoproteins that induce tumorigenesis when overexpressed. ETS homologous factor (EHF) has been found in kidney, lung and somatotroph tumors. ETS, potentially a tumor suppressor and senescence modulator, is most highly expressed in the organs known to form carcinomas upon 11p12 deletion. ETS may be a prognostic marker of carcinomas such as ovarian carcinoma.

Immunogen

Synthetic peptide directed towards the N terminal region of mouse Ehf

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD

Specificity

Anti-EHF polyclonal antibody reacts with human, mouse, rat, chicken, bovine, and canine ETS homologous factor proteins.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationmouse ... Ehf(13661)
mol wt33 kDa
NCBI accession no.NP_031940
Quality Level100
shipped inwet ice
species reactivityhuman, rat, mouse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9NZC4
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.