Anti-NKRF

Code: av39289-100ul D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-NKRF antibody is suitable for western blot applications at a concentration of 2.5 µg/ml.

Biochem/physiol Actions

NKR...


 Read more

Your Price
$456.36 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-NKRF antibody is suitable for western blot applications at a concentration of 2.5 µg/ml.

Biochem/physiol Actions

NKRF is a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. NKRF localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.This gene encodes a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. The protein localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

NKRF codes for a nuclear protein that functions as a repressing factor for NF-κB. NKRF suppresses the stimulation of hiNOS, IL-8, IFN, and HIV-1 by NFκB.Rabbit Anti-NKRF antibody recognizes bovine, human, mouse, rat, and canine NKRF.

Immunogen

Synthetic peptide directed towards the N terminal region of human NKRF

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MEKILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCDGQNPPKKQAGSK

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... NKRF(55922)
mol wt44 kDa
NCBI accession no.NP_060014
Quality Level100
shipped inwet ice
species reactivityhorse, pig, dog, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.O15226
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.