Anti-E2F7

Code: AV37583-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-E2F7 polyclonal antibody is used to tag E2F transcription factor 7 proteins for detection and quantitation by Western blotting and in cells and tissues by im...


 En savoir plus

Votre prix
$610.31 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-E2F7 polyclonal antibody is used to tag E2F transcription factor 7 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of E2F transcription factor 7 in the regulation of cell proliferation, especially at the level of G(1)/S gene activity during S-phase progression.

Biochem/physiol Actions

E2F7 is a E2F family member. It can block the E2F-dependent activation of a subset of E2F target genes as well as mitigate cellular proliferation of mouse embryo fibroblasts

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

E2F transcription factors are key regulators of cell growth, differentiation and cell death. E2F transcription factor 7 (E2F7) which is highly expressed during mid to late S-phase binds to the promoter regions of and represses G(1)/S-regulated genes thus promoting the downswing of oscillating G(1)/S genes during S-phase progression.

Immunogen

Synthetic peptide directed towards the N terminal region of mouse E2f7

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MEVNCLTLKDLISPRQTRLDFAIEDAENAQKENIFVDRSRMTPKTPMKNE

Specificity

Anti-E2F7 polyclonal antibody reacts with human, rat, canine, bovine, and mouse E2F transcription factor 7 proteins.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationmouse ... E2f7(52679)
mol wt99 kDa
NCBI accession no.NP_848724
Quality Level100
shipped inwet ice
species reactivityhuman, mouse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q8BSQ3
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.