Non disponible en dehors du Royaume-Uni et de l'Irlande
Biochem/physiol Actions
GJB2 also known as connexin 26 is a gap junction protein that belongs to the connexin family. It is a component of the gap junctions between cells that facilitate the diffusion of low molecular weight materials and ions from cell to cell. Mutations in GJB2 gene is one of the major factors the causes hereditary hearing loss and lethal form of Keratitis-Ichthyosis-Deafness Syndrome.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human GJB2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :