Anti-EBF2

Code: AV36019-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

EBF2 belongs to the EBF/COE family of transcription factors that contain well-conserved DNA-binding domain. EBF factors play important regulatory role...


 En savoir plus

Votre prix
$456.36 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

EBF2 belongs to the EBF/COE family of transcription factors that contain well-conserved DNA-binding domain. EBF factors play important regulatory roles in various developmental processes and in differentiation of osteoblasts. EBF2 is critical in the generation and migration of Cajal-Retzius neurons during early cortical neurogenesis in cerebral cortex.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human EBF2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VPRNPSQLPALSSSPAHSGMMGINSYGSQLGVSISESTQGNNQGYIRNTS

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... EBF2(64641)
mol wt61 kDa
NCBI accession no.NP_073150
Quality Level100
shipped inwet ice
species reactivityguinea pig, horse, mouse, human, rat, bovine, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9HAK2
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.