Anti-MCOLN1

Code: AV35307-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-MCOLN1 antibody is suitable for western blot applications at a concentration of 0.5 µg/ml.

Biochem/physiol Actions

M...


 En savoir plus

Votre prix
$610.31 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-MCOLN1 antibody is suitable for western blot applications at a concentration of 0.5 µg/ml.

Biochem/physiol Actions

MCOLN1 encodes a protein that may be involved in calcium signaling and membrane trafficking in mucolipidosis IV.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

MCOLN1 codes for a transmembrane protein that is found in vesicles. It is involved in endocytosis and lysosomal exocytosis. MCOLN1 mutations have been associated with the neurodegenerative lysosomal storage disorder, mucolipidosis type IV (MLIV).Rabbit Anti-MCOLN1 antibody recognizes bovine, canine, human, rat, and mouse MCOLN1.

Immunogen

Synthetic peptide directed towards the N terminal region of human MCOLN1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MCOLN1(57192)
mol wt64 kDa
NCBI accession no.NP_065394
Quality Level100
shipped inwet ice
species reactivitydog, human, rabbit, pig
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9GZU1
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.